PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA09G14400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 232aa    MW: 23968.5 Da    PI: 9.2528
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA09G14400.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.1e-384298662
           zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                      +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  ONIVA09G14400.1 42 DPCPRCESRDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGSRKSSTSS 98
                     57**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-234190IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7054296IPR003851Zinc finger, Dof-type
PfamPF027012.7E-324396IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MQEAGRRPAP QFAGVDLRRP KGYPAAAQLT PAAEEAAAGV GDPCPRCESR DTKFCYYNNY  60
NTSQPRHFCK SCRRYWTKGG SLRNVPVGGG SRKSSTSSSS SSSAAAAASS SSSPSSPAKS  120
PKRSKNSKRR RVSPPPPQPA PAPPPPTTAD AADVAAPTAP EDTTKKAPED LTAAAATQPA  180
VALGLGVADG GGGGKEHLDT SPFEWPSGCD LGPYWPTGVF ADTDPSLFLN LP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127131KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00672SELEXTransfer from GRMZM2G009406Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610919.13e-95PREDICTED: dof zinc finger protein MNB1A
SwissprotP385643e-59MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLA0A0E0IL791e-165A0A0E0IL79_ORYNI; Uncharacterized protein
STRINGLOC_Os09g29960.19e-95(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-26DOF zinc finger protein 1